The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
PDB DOI: 10.2210/pdb1fav/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct
Deposited: 2000-07-13 Deposition Author(s): Chopra, R. , Ferrer, M. , Harrison, S.C. , Oprian, D. , Schreiber, S.L. , Skehel, J.J. , Strassmaier, T. , Weissenhorn, W. , Wiley, D.C. , Zhou, G.
Method: X-RAY DIFFRACTION Resolution: 3 Å
The structure of an hiv-1 specific cell entry inhibitor in complex with the hiv-1 gp41 trimeric core
Chopra, R. , Ferrer, M. , Harrison, S.C. , Oprian, D. , Schreiber, S.L. , Skehel, J.J. , Strassmaier, T. , Weissenhorn, W. , Wiley, D.C. , Zhou, G.
Primary Citation of Related Structures: 1FAV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 ENVELOPE PROTEIN CHIMERA | A | 79 | Human Immunodeficiency Virus 1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | QIEDKIEEILSKIYHIENEIARIKKLIGEARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ |
| PROTEIN (TRANSMEMBRANE GLYCOPROTEIN) | C | 33 | Human Immunodeficiency Virus 1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | XEXNNYTSLIHSLIEESQNQQEKNEQELLELDK |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-07-13 Deposition Author(s): Chopra, R. , Ferrer, M. , Harrison, S.C. , Oprian, D. , Schreiber, S.L. , Skehel, J.J. , Strassmaier, T. , Weissenhorn, W. , Wiley, D.C. , Zhou, G.