Crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
PDB DOI: 10.2210/pdb1f2p/pdb
Classification: HYDROLASE Organism(s): Streptomyces Griseus
Deposited: 2000-05-28 Deposition Author(s): Blumberg, S. , Gilboa, R. , Schomburg, D. , Shoham, G. , Spungin-Bialik, A. , Wohlfahrt, G.
Crystal structure of the streptomyces griseus aminopeptidase complexed with l-phenylalanine
Blumberg, S. , Gilboa, R. , Schomburg, D. , Shoham, G. , Spungin-Bialik, A. , Wohlfahrt, G.
Primary Citation of Related Structures: 1F2P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| AMINOPEPTIDASE | A | 284 | Streptomyces Griseus | APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSSGTGEPPT |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-05-28 Deposition Author(s): Blumberg, S. , Gilboa, R. , Schomburg, D. , Shoham, G. , Spungin-Bialik, A. , Wohlfahrt, G.