Crystal structure of the green fluorescent protein (gfp) variant yfp-h148q with two bound iodides
PDB DOI: 10.2210/pdb1f09/pdb
Classification: LUMINESCENT PROTEIN Organism(s): Aequorea Victoria
Deposited: 2000-05-15 Deposition Author(s): Kallio, K. , Remington, S.J. , Wachter, R.M. , Yarbrough, D.
Crystal structure of the green fluorescent protein (gfp) variant yfp-h148q with two bound iodides
Kallio, K. , Remington, S.J. , Wachter, R.M. , Yarbrough, D.
Primary Citation of Related Structures: 1F09
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GREEN FLUORESCENT PROTEIN | A | 238 | Aequorea Victoria | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSQNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-05-15 Deposition Author(s): Kallio, K. , Remington, S.J. , Wachter, R.M. , Yarbrough, D.