Ferredoxin vi from rhodobacter capsulatus
PDB DOI: 10.2210/pdb1e9m/pdb
Classification: IRON-SULFUR PROTEIN Organism(s): Rhodobacter Capsulatus
Deposited: 2000-10-24 Deposition Author(s): Armengaud, J. , Jouanneau, Y. , Larry, S. , Sainz, G. , Sanishvili, N. , Stojanoff, V.
Ferredoxin vi from rhodobacter capsulatus
Armengaud, J. , Jouanneau, Y. , Larry, S. , Sainz, G. , Sanishvili, N. , Stojanoff, V.
Primary Citation of Related Structures: 1E9M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FERREDOXIN VI | A | 106 | Rhodobacter Capsulatus | AKIIFIEHNGTRHEVEAKPGLTVMEAARDNGVPGIDADCGGACACSTCHAYVDPAWVDKLPKALPTETDMIDFAYEPNPATSRLTCQIKVTSLLDGLVVHLPEKQI |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-10-24 Deposition Author(s): Armengaud, J. , Jouanneau, Y. , Larry, S. , Sainz, G. , Sanishvili, N. , Stojanoff, V.