Characterisation of the cellulose docking domain from piromyces equi
PDB DOI: 10.2210/pdb1e8q/pdb
Classification: CELLULOSE DOCKING DOMAIN Organism(s): Piromyces Equi
Deposited: 2000-09-28 Deposition Author(s): Eberhardt, R.Y. , Gilbert, H.J. , Hazlewood, G.P. , Raghothama, S. , Simpson, P.J. , White, P. , Williamson, M.P.
Characterisation of the cellulose docking domain from piromyces equi
Eberhardt, R.Y. , Gilbert, H.J. , Hazlewood, G.P. , Raghothama, S. , Simpson, P.J. , White, P. , Williamson, M.P.
Primary Citation of Related Structures: 1E8Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endoglucanase 45A | A | 46 | Piromyces Equi | ASCWAQSQGYNCCNNPSSTKVEYTDASGQWGVQNGQWCGIDYSYGQ |
Method: SOLUTION NMR
Deposited Date: 2000-09-28 Deposition Author(s): Eberhardt, R.Y. , Gilbert, H.J. , Hazlewood, G.P. , Raghothama, S. , Simpson, P.J. , White, P. , Williamson, M.P.