Crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana
PDB DOI: 10.2210/pdb1dcf/pdb
Classification: TRANSFERASE Organism(s): Arabidopsis Thaliana
Deposited: 1999-11-04 Deposition Author(s): Grantz, A. , Kim, S.H. , Muller-Dieckmann, H.J.
Crystal structure of the receiver domain of the ethylene receptor of arabidopsis thaliana
Grantz, A. , Kim, S.H. , Muller-Dieckmann, H.J.
Primary Citation of Related Structures: 1DCF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ETR1 PROTEIN | A | 136 | Arabidopsis Thaliana | HMSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-11-04 Deposition Author(s): Grantz, A. , Kim, S.H. , Muller-Dieckmann, H.J.