Solution structure of the type i dockerin domain from the clostridium thermocellum cellulosome (minimized average structure)
PDB DOI: 10.2210/pdb1daq/pdb
Classification: HYDROLASE Organism(s): Clostridium Thermocellum
Deposited: 1999-10-31 Deposition Author(s): Heckman, M.P. , Lytle, B.L. , Volkman, B.F. , Westler, W.M. , Wu, J.H.D.
Solution structure of the type i dockerin domain from the clostridium thermocellum cellulosome (minimized average structure)
Heckman, M.P. , Lytle, B.L. , Volkman, B.F. , Westler, W.M. , Wu, J.H.D.
Primary Citation of Related Structures: 1DAQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ENDOGLUCANASE SS | A | 71 | Clostridium Thermocellum | MSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKNG |
Method: SOLUTION NMR
Deposited Date: 1999-10-31 Deposition Author(s): Heckman, M.P. , Lytle, B.L. , Volkman, B.F. , Westler, W.M. , Wu, J.H.D.