Crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.
PDB DOI: 10.2210/pdb1czq/pdb
Classification: Viral protein/inhibitor Organism(s): Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1999-09-06 Deposition Author(s): Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.
Crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.
Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.
Primary Citation of Related Structures: 1CZQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
FUSION PROTEIN BETWEEN THE HYDROPHOBIC POCKET OF HIV GP41 AND GCN4-PIQI | A | 46 | Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XRMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL |
D-PEPTIDE INHIBITOR | D | 17 | Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XGACEARHREWAWLCAA |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-09-06 Deposition Author(s): Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.