PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1CZQ

Crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.

PDB DOI: 10.2210/pdb1czq/pdb

Classification: Viral protein/inhibitor
Organism(s): Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 1999-09-06
Deposition Author(s): Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.5 Å

Literature

Crystal structure of the d10-p1/iqn17 complex: a d-peptide inhibitor of hiv-1 entry bound to the gp41 coiled-coil pocket.

Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.

Primary Citation of Related Structures: 1CZQ


Proteins
Molecule Chains Sequence Length Organism Sequence
FUSION PROTEIN BETWEEN THE HYDROPHOBIC POCKET OF HIV GP41 AND GCN4-PIQI A 46 Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XRMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
D-PEPTIDE INHIBITOR D 17 Thermus Oshimai Jl-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XGACEARHREWAWLCAA
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 1999-09-06
Deposition Author(s): Carr, P.A. , Eckert, D.M. , Hong, L.H. , Kim, P.S. , Malashkevich, V.N.