The x-ray structure of (mebm2t)1-cyclosporin complexed with cyclophilin a provides an explanation for its anomalously high immunosuppressive activity
PDB DOI: 10.2210/pdb1cwb/pdb
Classification: ISOMERASE/IMMUNOSUPPRESSANT Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 1995-09-06 Deposition Author(s): Kallen, J. , Mikol, V. , Walkinshaw, M.D.
The x-ray structure of (mebm2t)1-cyclosporin complexed with cyclophilin a provides an explanation for its anomalously high immunosuppressive activity
Kallen, J. , Mikol, V. , Walkinshaw, M.D.
Primary Citation of Related Structures: 1CWB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PEPTIDYL-PROLYL CIS-TRANS ISOMERASE A | A | 165 | Homo Sapiens , Synthetic Construct | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| CYCLOSPORIN A | C | 11 | Homo Sapiens , Synthetic Construct | ALLVXAGLVLA |
Method: X-RAY DIFFRACTION
Deposited Date: 1995-09-06 Deposition Author(s): Kallen, J. , Mikol, V. , Walkinshaw, M.D.