How an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf-like domain in coagulation factor x
PDB DOI: 10.2210/pdb1ccf/pdb
Classification: COAGULATION FACTOR Organism(s): Bos Taurus
Deposited: 1993-05-19 Deposition Author(s): Drakenberg, T. , Persson, M. , Selander-Sunnerhagen, M. , Stenflo, J. , Teleman, O. , Ullner, M.
How an epidermal growth factor (egf)-like domain binds calcium-high resolution nmr structure of the calcium form of the nh2-terminal egf-like domain in coagulation factor x
Drakenberg, T. , Persson, M. , Selander-Sunnerhagen, M. , Stenflo, J. , Teleman, O. , Ullner, M.
Primary Citation of Related Structures: 1CCF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| COAGULATION FACTOR X | A | 42 | Bos Taurus | KDGDQCEGHPCLNQGHCKDGIGDYTCTCAEGFEGKNCEFSTR |
Method: SOLUTION NMR
Deposited Date: 1993-05-19 Deposition Author(s): Drakenberg, T. , Persson, M. , Selander-Sunnerhagen, M. , Stenflo, J. , Teleman, O. , Ullner, M.