Crystal structure of the atx1 metallochaperone protein
PDB DOI: 10.2210/pdb1cc8/pdb
Classification: METAL TRANSPORT Organism(s): Saccharomyces Cerevisiae
Deposited: 1999-03-04 Deposition Author(s): Hou, T.V.O. , Huffman, D.L. , Pufahl, M.Y.R.A. , Rosenzweig, A.C. , Wernimont, A.K.
Crystal structure of the atx1 metallochaperone protein
Hou, T.V.O. , Huffman, D.L. , Pufahl, M.Y.R.A. , Rosenzweig, A.C. , Wernimont, A.K.
Primary Citation of Related Structures: 1CC8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN (METALLOCHAPERONE ATX1) | A | 73 | Saccharomyces Cerevisiae | MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-03-04 Deposition Author(s): Hou, T.V.O. , Huffman, D.L. , Pufahl, M.Y.R.A. , Rosenzweig, A.C. , Wernimont, A.K.