Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
PDB DOI: 10.2210/pdb1c8c/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Paramecium Tetraurelia Strain D4-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-05-04 Deposition Author(s): Edmondson, S.P. , Gao, Y.-G. , Liaw, Y.-C. , Robinson, H. , Shriver, J.W. , Su, S. , Wang, A.H.-J.
Crystal structures of the chromosomal proteins sso7d/sac7d bound to dna containing t-g mismatched base pairs
Edmondson, S.P. , Gao, Y.-G. , Liaw, Y.-C. , Robinson, H. , Shriver, J.W. , Su, S. , Wang, A.H.-J.
Primary Citation of Related Structures: 1C8C
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA-BINDING PROTEIN 7A | A | 64 | Paramecium Tetraurelia Strain D4-2 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLAKQKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2000-05-04 Deposition Author(s): Edmondson, S.P. , Gao, Y.-G. , Liaw, Y.-C. , Robinson, H. , Shriver, J.W. , Su, S. , Wang, A.H.-J.