Solution structure of bovine neutrophil beta-defensin 12: the peptide fold of the beta-defensins is identical to that of the classical defensins
PDB DOI: 10.2210/pdb1bnb/pdb
Classification: BETA-DEFENSIN 12 Organism(s): Bos Taurus
Deposited: 1995-03-08 Deposition Author(s): Legault, P. , Pardi, A. , Selsted, M.E. , Zimmermann, G.R.
Solution structure of bovine neutrophil beta-defensin 12: the peptide fold of the beta-defensins is identical to that of the classical defensins
Legault, P. , Pardi, A. , Selsted, M.E. , Zimmermann, G.R.
Primary Citation of Related Structures: 1BNB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| BOVINE NEUTROPHIL BETA-DEFENSIN 12 | A | 38 | Bos Taurus | APLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
Method: SOLUTION NMR
Deposited Date: 1995-03-08 Deposition Author(s): Legault, P. , Pardi, A. , Selsted, M.E. , Zimmermann, G.R.