1h nmr of (12-53) ncp7/d(acgcc) complex, 10 structures
PDB DOI: 10.2210/pdb1bj6/pdb
Classification: Viral protein/DNA Organism(s): Human Immunodeficiency Virus 1 , Synthetic Construct
Deposited: 1998-07-03 Deposition Author(s): De Rocquigny, H. , Demene, H. , Fournie-Zaluski, M.C. , Huynh-Dinh, T. , Morellet, N. , Roques, B.P. , Teilleux, V.
Method: SOLUTION NMR Resolution: N.A.
1h nmr of (12-53) ncp7/d(acgcc) complex, 10 structures
De Rocquigny, H. , Demene, H. , Fournie-Zaluski, M.C. , Huynh-Dinh, T. , Morellet, N. , Roques, B.P. , Teilleux, V.
Primary Citation of Related Structures: 1BJ6
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(*AP*CP*GP*CP*C)-3') | d | 5 | NA | ACGCC |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NUCLEOCAPSID PROTEIN 7 | A | 42 | Human Immunodeficiency Virus 1 , Synthetic Construct | NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQ |
Method: SOLUTION NMR
Deposited Date: 1998-07-03 Deposition Author(s): De Rocquigny, H. , Demene, H. , Fournie-Zaluski, M.C. , Huynh-Dinh, T. , Morellet, N. , Roques, B.P. , Teilleux, V.