Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, minimized average structure
PDB DOI: 10.2210/pdb1bdd/pdb
Classification: IMMUNOGLOBULIN-BINDING PROTEIN Organism(s): Staphylococcus Aureus
Deposited: 1996-06-28 Deposition Author(s): Arata, Y. , Gouda, H. , Saito, A. , Sato, M. , Shimada, I. , Torigoe, H.
Method: SOLUTION NMR Resolution: N.A.
Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, minimized average structure
Arata, Y. , Gouda, H. , Saito, A. , Sato, M. , Shimada, I. , Torigoe, H.
Primary Citation of Related Structures: 1BDD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| STAPHYLOCOCCUS AUREUS PROTEIN A | A | 60 | Staphylococcus Aureus | TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA |
Method: SOLUTION NMR
Deposited Date: 1996-06-28 Deposition Author(s): Arata, Y. , Gouda, H. , Saito, A. , Sato, M. , Shimada, I. , Torigoe, H.