Hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4
PDB DOI: 10.2210/pdb1b6l/pdb
Classification: HYDROLASE/HYDROLASE INHIBITOR Organism(s): Human Immunodeficiency Virus 1
Deposited: 1999-01-17 Deposition Author(s): Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.
Hiv-1 protease complexed with macrocyclic peptidomimetic inhibitor 4
Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.
Primary Citation of Related Structures: 1B6L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RETROPEPSIN | A | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
| RETROPEPSIN | B | 99 | Human Immunodeficiency Virus 1 | PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 1999-01-17 Deposition Author(s): Abbenante, G. , Alewood, D. , Alewood, P.F. , Begun, J. , Bergman, D.A. , Brinkworth, R.I. , Fairlie, D.P. , March, D.R. , Martin, J.L. , Reid, R.C. , Schindeler, A. , Wickramasinghe, W.A.