Crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
PDB DOI: 10.2210/pdb1ayd/pdb
Classification: HYDROLASE(SH2 DOMAIN) Organism(s): Mus Musculus
Deposited: 1994-05-15 Deposition Author(s): Kuriyan, J. , Lee, C.-H.
Crystal structures of peptide complexes of the amino-terminal sh2 domain of the syp tyrosine phosphatase
Primary Citation of Related Structures: 1AYD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PROTEIN-TYROSINE PHOSPHATASE SYP (N-TERMINAL SH2 DOMAIN) | A | 101 | Mus Musculus | MRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-05-15 Deposition Author(s): Kuriyan, J. , Lee, C.-H.