Determination of the nmr solution structure of an antennapedia homeodomain-dna complex
PDB DOI: 10.2210/pdb1ahd/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Drosophila Subobscura , Synthetic Construct
Deposited: 1993-04-02 Deposition Author(s): Billeter, M. , Gehring, W.J. , Muller, M. , Otting, G. , Qian, Y.Q. , Wuthrich, K.
Method: SOLUTION NMR Resolution: N.A.
Determination of the nmr solution structure of an antennapedia homeodomain-dna complex
Billeter, M. , Gehring, W.J. , Muller, M. , Otting, G. , Qian, Y.Q. , Wuthrich, K.
Primary Citation of Related Structures: 1AHD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Homeotic protein antennapedia | P | 68 | Drosophila Subobscura , Synthetic Construct | MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKENKTKGEPG |
Method: SOLUTION NMR
Deposited Date: 1993-04-02 Deposition Author(s): Billeter, M. , Gehring, W.J. , Muller, M. , Otting, G. , Qian, Y.Q. , Wuthrich, K.