The three-dimensional structure of a helix-less variant of intestinal fatty acid binding protein, nmr, 20 structures
PDB DOI: 10.2210/pdb1a57/pdb
Classification: FATTY ACID-BINDING Organism(s): Rattus Norvegicus
Deposited: 1998-02-20 Deposition Author(s): Cistola, D.P. , Emmert, D.A. , Frieden, C. , Hodsdon, M.E. , Kao, J. , Steele, R.A.
The three-dimensional structure of a helix-less variant of intestinal fatty acid binding protein, nmr, 20 structures
Cistola, D.P. , Emmert, D.A. , Frieden, C. , Hodsdon, M.E. , Kao, J. , Steele, R.A.
Primary Citation of Related Structures: 1A57
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| INTESTINAL FATTY ACID-BINDING PROTEIN | A | 116 | Rattus Norvegicus | AFDGTWKVDRNENYSGAHDNLKLTITQEGNKFTVKESSNFRNIDVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE |
Method: SOLUTION NMR
Deposited Date: 1998-02-20 Deposition Author(s): Cistola, D.P. , Emmert, D.A. , Frieden, C. , Hodsdon, M.E. , Kao, J. , Steele, R.A.