Fadd death effector domain, f25y mutant, nmr minimized average structure
PDB DOI: 10.2210/pdb1a1w/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 1997-12-18 Deposition Author(s): Chen, Z. , Eberstadt, M. , Fesik, S.W. , Huang, B. , Meadows, R.P. , Ng, C.
Method: SOLUTION NMR Resolution: N.A.
Fadd death effector domain, f25y mutant, nmr minimized average structure
Chen, Z. , Eberstadt, M. , Fesik, S.W. , Huang, B. , Meadows, R.P. , Ng, C.
Primary Citation of Related Structures: 1A1W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FADD PROTEIN | A | 91 | Homo Sapiens | MDPFLVLLHSVSSSLSSSELTELKYLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFELEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 1997-12-18 Deposition Author(s): Chen, Z. , Eberstadt, M. , Fesik, S.W. , Huang, B. , Meadows, R.P. , Ng, C.