Role of backbone flexibility in the accommodation of variants that repack the core of t4 lysozyme
PDB DOI: 10.2210/pdb145l/pdb
Classification: HYDROLASE(O-GLYCOSYL) Organism(s): Enterobacteria Phage T4
Deposited: 1993-10-15 Deposition Author(s): Baldwin, E. , Matthews, B.W.
Role of backbone flexibility in the accommodation of variants that repack the core of t4 lysozyme
Primary Citation of Related Structures: 145L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| T4 LYSOZYME | A | 164 | Enterobacteria Phage T4 | MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMIQQKRWDEWAVNMAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL |
Method: X-RAY DIFFRACTION
Deposited Date: 1993-10-15 Deposition Author(s): Baldwin, E. , Matthews, B.W.