12LO
X-ray crystal structure of protein gb1 mutant k13a
PDB DOI: 10.2210/pdb12lo/pdb
Classification: IMMUNE SYSTEM Organism(s): Streptococcus Sp. Group G
Deposited: 2026-04-12 Deposition Author(s): Christianson, D.W. , Roose, B.W.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.37 Å
X-ray crystal structure of protein gb1 mutant k13a
Christianson, D.W. , Roose, B.W.
Primary Citation of Related Structures: 12LO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G | A | 56 | Streptococcus Sp. Group G | MQYKLILNGKTLAGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2026-04-12 Deposition Author(s): Christianson, D.W. , Roose, B.W.