9XEA
Structure of the transmembrane domain dimer of human il-7r v253g mutant
PDB DOI: 10.2210/pdb9xea/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2025-10-27 Deposition Author(s): Cai, T. , Chou, J.J. , Wang, Q.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the transmembrane domain dimer of human il-7r v253g mutant
Cai, T. , Chou, J.J. , Wang, Q.
Primary Citation of Related Structures: 9XEA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Interleukin-7 receptor subunit alpha | A | 31 | Homo Sapiens | GEKDPILLTISILSFFSGALLVILAHVLWKK |
| Interleukin-7 receptor subunit alpha | B | 31 | Homo Sapiens | GEKDPILLTISILSFFSGALLVILAHVLWKK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2025-10-27 Deposition Author(s): Cai, T. , Chou, J.J. , Wang, Q.