Solution structure of n-terminal domain of mouse hbs1l protein
PDB DOI: 10.2210/pdb9wpr/pdb
Classification: TRANSLATION Organism(s): Mus Musculus
Deposited: 2025-09-09 Deposition Author(s): Aoki, M. , Guntert, P. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Kuwasako, K. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Terada, T. , Tsuda, K. , Yabuki, T. , Yokoyama, S. , Yoshida, M.
Solution structure of n-terminal domain of mouse hbs1l protein
Aoki, M. , Guntert, P. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Kuwasako, K. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Terada, T. , Tsuda, K. , Yabuki, T. , Yokoyama, S. , Yoshida, M.
Primary Citation of Related Structures: 9WPR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HBS1-like protein | A | 83 | Mus Musculus | GSSGSSGEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2025-09-09 Deposition Author(s): Aoki, M. , Guntert, P. , Hayami, N. , Hayashizaki, Y. , He, F. , Hirota, H. , Inoue, M. , Kigawa, T. , Kobayashi, N. , Kuwasako, K. , Matsuda, T. , Matsuo, Y. , Muto, Y. , Nagata, T. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Seki, E. , Shirouzu, M. , Takahashi, M. , Tanaka, A. , Terada, T. , Tsuda, K. , Yabuki, T. , Yokoyama, S. , Yoshida, M.