Kcmf1 zn-coordinating domains with rtgg peptide
PDB DOI: 10.2210/pdb9upz/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2025-04-29 Deposition Author(s): Lee, J.Y. , Shin, J.S. , Song, H.K.
Method: X-RAY DIFFRACTION Resolution: 1.71 Å
Kcmf1 zn-coordinating domains with rtgg peptide
Lee, J.Y. , Shin, J.S. , Song, H.K.
Primary Citation of Related Structures: 9UPZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase KCMF1 | A | 124 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SRHEGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCIGGGGSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPNHVTDDFAAHLTLEHELRARL |
ARG-THR-GLY-GLY | D | 3 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RTG |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-04-29 Deposition Author(s): Lee, J.Y. , Shin, J.S. , Song, H.K.