9RXT
Structure of the pdz1 domain from human nherf1 with the c-terminal residues (natrl) of the human sodium-dependent phosphate transporter 2a (napi-iia, slc34a1)
PDB DOI: 10.2210/pdb9rxt/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2025-07-11 Deposition Author(s): Hunte, C. , Kern, B.A. , Mymrikov, E.V. , Wirth, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.36 Å
Structure of the pdz1 domain from human nherf1 with the c-terminal residues (natrl) of the human sodium-dependent phosphate transporter 2a (napi-iia, slc34a1)
Hunte, C. , Kern, B.A. , Mymrikov, E.V. , Wirth, C.
Primary Citation of Related Structures: 9RXT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Sodium-dependent phosphate transport protein 2A | A | 90 | Homo Sapiens | GLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPENATRL |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2025-07-11 Deposition Author(s): Hunte, C. , Kern, B.A. , Mymrikov, E.V. , Wirth, C.