9RXQ
Structure of the pdz1 domain from human nherf1 with the c-terminal residues (kstqf) of human urat1 transporter (slc22a12)
PDB DOI: 10.2210/pdb9rxq/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2025-07-11 Deposition Author(s): Heinicke, J.I. , Hunte, C. , Mymrikov, E.V. , Wirth, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.38 Å
Structure of the pdz1 domain from human nherf1 with the c-terminal residues (kstqf) of human urat1 transporter (slc22a12)
Heinicke, J.I. , Hunte, C. , Mymrikov, E.V. , Wirth, C.
Primary Citation of Related Structures: 9RXQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Solute carrier family 22 member 12 | A | 90 | Homo Sapiens | GLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPEKSTQF |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Solute carrier family 22 member 12 | B | 90 | Homo Sapiens | GLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPEKSTQF |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2025-07-11 Deposition Author(s): Heinicke, J.I. , Hunte, C. , Mymrikov, E.V. , Wirth, C.