9RSV
Complex of rice blast (magnaporthe oryzae) effector protein avr-pia with the hma domain of oshpp09 from rice (oryza sativa)
PDB DOI: 10.2210/pdb9rsv/pdb
Classification: PLANT PROTEIN Organism(s): Anthocerotibacter Panamensis , Pantoea Stewartii Subsp. Stewartii
Deposited: 2025-07-01 Deposition Author(s): Bocquet, A. , Cesari, S. , De Guillen, K. , Gelin, M. , Maidment, J.H.R.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Complex of rice blast (magnaporthe oryzae) effector protein avr-pia with the hma domain of oshpp09 from rice (oryza sativa)
Bocquet, A. , Cesari, S. , De Guillen, K. , Gelin, M. , Maidment, J.H.R.
Primary Citation of Related Structures: 9RSV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Os03g0111400 protein | A | 75 | Anthocerotibacter Panamensis , Pantoea Stewartii Subsp. Stewartii | GPMAQQKVVLKVPTMTDEKTKQKAIEAVADIYGIDSIAADLKDNKMTIIGDMDTVEIAKKLRKIGKIDIVSVGPA |
| AVR-Pia protein | B | 70 | Anthocerotibacter Panamensis , Pantoea Stewartii Subsp. Stewartii | GHMAAPARFCVYYDGHLPATRVLLMYVRIGTTATITARGHEFEVEAKDQNCKVILTNGKQAPDWLAAEPY |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2025-07-01 Deposition Author(s): Bocquet, A. , Cesari, S. , De Guillen, K. , Gelin, M. , Maidment, J.H.R.