9RCA
Solution nmr structure of the lipoyl domain of the e2 subunit in the human alpha-ketoglutarate dehydrogenase complex
PDB DOI: 10.2210/pdb9rca/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2025-05-27 Deposition Author(s): Ambrus, A. , Batta, G. , Czajlik, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the lipoyl domain of the e2 subunit in the human alpha-ketoglutarate dehydrogenase complex
Ambrus, A. , Batta, G. , Czajlik, A.
Primary Citation of Related Structures: 9RCA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial | A | 84 | Homo Sapiens | GPGDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2025-05-27 Deposition Author(s): Ambrus, A. , Batta, G. , Czajlik, A.