Spitrobot-2 advances time-resolvedcryo-trapping crystallography to under 25 ms: human insulin, ph 9.0 (apo state)
PDB DOI: 10.2210/pdb9r48/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2025-05-07 Deposition Author(s): Hatton, C.E. , Mehrabi, P. , Schulz, E.C. , Spiliopoulou, M.
Spitrobot-2 advances time-resolvedcryo-trapping crystallography to under 25 ms: human insulin, ph 9.0 (apo state)
Hatton, C.E. , Mehrabi, P. , Schulz, E.C. , Spiliopoulou, M.
Primary Citation of Related Structures: 9R48
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-05-07 Deposition Author(s): Hatton, C.E. , Mehrabi, P. , Schulz, E.C. , Spiliopoulou, M.