9QLM
Solution structure of the taf3-phd bound to a h3k4me3q5ser histone tail peptide with a serotonylated glutamine
PDB DOI: 10.2210/pdb9qlm/pdb
Classification: GENE REGULATION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2025-03-21 Deposition Author(s): Bonvin, A.M.J.J. , Gielingh, H. , Honorato, R.V. , Jongkees, S. , Liu, M. , Pulido-Cortes, L. , Soares, L.R. , Thijssen, V. , Timmers, H.Th.M. , Van Ingen, H. , Yoshisada, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the taf3-phd bound to a h3k4me3q5ser histone tail peptide with a serotonylated glutamine
Bonvin, A.M.J.J. , Gielingh, H. , Honorato, R.V. , Jongkees, S. , Liu, M. , Pulido-Cortes, L. , Soares, L.R. , Thijssen, V. , Timmers, H.Th.M. , Van Ingen, H. , Yoshisada, R.
Primary Citation of Related Structures: 9QLM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 3 | A | 75 | Mus Musculus , Synthetic Construct | GSHMAMAYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMAAPPEEMQWFCPKCANKIKKDKKH |
| Histone H3.1 | B | 12 | Mus Musculus , Synthetic Construct | ARTKETARKSTG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2025-03-21 Deposition Author(s): Bonvin, A.M.J.J. , Gielingh, H. , Honorato, R.V. , Jongkees, S. , Liu, M. , Pulido-Cortes, L. , Soares, L.R. , Thijssen, V. , Timmers, H.Th.M. , Van Ingen, H. , Yoshisada, R.