9QLD
Rhombohedral crystalline form of human insulin complexed with m-nitrophenol
PDB DOI: 10.2210/pdb9qld/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2025-03-20 Deposition Author(s): Kafetzi, S. , Konstantopoulos, M. , Kontarinis, A. , Koutoulas, D. , Margiolaki, I. , Nanao, M.H. , Papaefthymiou, C.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.55 Å
Rhombohedral crystalline form of human insulin complexed with m-nitrophenol
Kafetzi, S. , Konstantopoulos, M. , Kontarinis, A. , Koutoulas, D. , Margiolaki, I. , Nanao, M.H. , Papaefthymiou, C.
Primary Citation of Related Structures: 9QLD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin A chain | C | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Insulin B chain | D | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2025-03-20 Deposition Author(s): Kafetzi, S. , Konstantopoulos, M. , Kontarinis, A. , Koutoulas, D. , Margiolaki, I. , Nanao, M.H. , Papaefthymiou, C.