Solution structure of the beta domain of human mt1a bound to 6 cu(i) ions
PDB DOI: 10.2210/pdb9q7p/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2025-08-25 Deposition Author(s): Melenbacher, A. , Rintala-Dempsey, A.C. , Shaw, G.S. , Stillman, M.J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the beta domain of human mt1a bound to 6 cu(i) ions
Melenbacher, A. , Rintala-Dempsey, A.C. , Shaw, G.S. , Stillman, M.J.
Primary Citation of Related Structures: 9Q7P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G-binding protein G, Metallothionein-1A fusion,Metallothionein-1A | A | 90 | Homo Sapiens | GPMQYKLALNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEMDPNCSCATGGSCTCTGSCKCKECKCTSCKKS |
Method: SOLUTION NMR
Deposited Date: 2025-08-25 Deposition Author(s): Melenbacher, A. , Rintala-Dempsey, A.C. , Shaw, G.S. , Stillman, M.J.