9PFE
Nmr structure of slow skeletal myosin binding protein-c m-domain tri-helix bundle
PDB DOI: 10.2210/pdb9pfe/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Homo Sapiens
Deposited: 2025-07-04 Deposition Author(s): Iyer, A. , Kontrogianni-Konstantopoulos, A. , Wright, N.T.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of slow skeletal myosin binding protein-c m-domain tri-helix bundle
Iyer, A. , Kontrogianni-Konstantopoulos, A. , Wright, N.T.
Primary Citation of Related Structures: 9PFE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 4 of Myosin-binding protein C, slow-type | A | 45 | Homo Sapiens | MPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2025-07-04 Deposition Author(s): Iyer, A. , Kontrogianni-Konstantopoulos, A. , Wright, N.T.