High-resolution solution structure of reduced french bean plastocyanin and comparison with the crystal structure of poplar plastocyanin
PDB DOI: 10.2210/pdb9pcy/pdb
Classification: ELECTRON TRANSPORT Organism(s): Phaseolus Vulgaris
Deposited: 1991-03-18 Deposition Author(s): Case, D.A. , Chazin, W.J. , Gippert, G.P. , Lepre, C.A. , Moore, J.M. , Wright, P.E.
High-resolution solution structure of reduced french bean plastocyanin and comparison with the crystal structure of poplar plastocyanin
Case, D.A. , Chazin, W.J. , Gippert, G.P. , Lepre, C.A. , Moore, J.M. , Wright, P.E.
Primary Citation of Related Structures: 9PCY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PLASTOCYANIN | A | 99 | Phaseolus Vulgaris | LEVLLGSGDGSLVFVPSEFSVPSGEKIVFKNNAGFPHNVVFDEDEIPAGVDAVKISMPEEELLNAPGETYVVTLDTKGTYSFYCSPHQGAGMVGKVTVN |
Method: SOLUTION NMR
Deposited Date: 1991-03-18 Deposition Author(s): Case, D.A. , Chazin, W.J. , Gippert, G.P. , Lepre, C.A. , Moore, J.M. , Wright, P.E.