Serial synchrotron x-ray diffraction structure of papain microcrystals soaked with a mixture of e-64, e-64c, and e-64d
PDB DOI: 10.2210/pdb9nbn/pdb
Classification: HYDROLASE Organism(s): Carica Papaya
Deposited: 2025-02-14 Deposition Author(s): Rodriguez, J.A. , Summers, J.A. , Vlahakis, N.W. , Wakatsuki, S.
Serial synchrotron x-ray diffraction structure of papain microcrystals soaked with a mixture of e-64, e-64c, and e-64d
Rodriguez, J.A. , Summers, J.A. , Vlahakis, N.W. , Wakatsuki, S.
Primary Citation of Related Structures: 9NBN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Papain | A | 212 | Carica Papaya | IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-02-14 Deposition Author(s): Rodriguez, J.A. , Summers, J.A. , Vlahakis, N.W. , Wakatsuki, S.