Microed structure of papain complexed with natural product e-64-a65 from microcrystals soaked in crude biosynthetic reaction mixture
PDB DOI: 10.2210/pdb9nay/pdb
Classification: HYDROLASE Organism(s): Carica Papaya
Deposited: 2025-02-13 Deposition Author(s): Rodriguez, J.A. , Vlahakis, N.W.
Method: ELECTRON CRYSTALLOGRAPHY Resolution: 2.5 Å
Microed structure of papain complexed with natural product e-64-a65 from microcrystals soaked in crude biosynthetic reaction mixture
Rodriguez, J.A. , Vlahakis, N.W.
Primary Citation of Related Structures: 9NAY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Papain | A | 212 | Carica Papaya | IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
Method: ELECTRON CRYSTALLOGRAPHY
Deposited Date: 2025-02-13 Deposition Author(s): Rodriguez, J.A. , Vlahakis, N.W.