Crystal structure of fkbp12 complexed with small molecule anchor for protein-201
PDB DOI: 10.2210/pdb9lyg/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2025-02-20 Deposition Author(s): Kato, S. , Katoh, A. , Matsuoka, S. , Sugiyama, S. , Tsuchikawa, H.
Crystal structure of fkbp12 complexed with small molecule anchor for protein-201
Kato, S. , Katoh, A. , Matsuoka, S. , Sugiyama, S. , Tsuchikawa, H.
Primary Citation of Related Structures: 9LYG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase FKBP1A | A | 111 | Homo Sapiens | GSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-02-20 Deposition Author(s): Kato, S. , Katoh, A. , Matsuoka, S. , Sugiyama, S. , Tsuchikawa, H.