Crystal structure of the l7ae derivative protein ls4 in complex with its co-evolved target cs1 rna
PDB DOI: 10.2210/pdb9l6x/pdb
Classification: RNA BINDING PROTEIN
Organism(s): Archaeoglobus Fulgidus (Strain Atcc 49558 / Dsm 4304 / Jcm 9628 / Nbrc 100126 / Vc-16) , Synthetic Construct
Deposited: 2024-12-25
Deposition Author(s): Fukunaga, K. , Kakuta, Y. , Nakashima, M. , Teramoto, T. , Yokobayashi, Y.
Crystal structure of the l7ae derivative protein ls4 in complex with its co-evolved target cs1 rna
Fukunaga, K. , Kakuta, Y. , Nakashima, M. , Teramoto, T. , Yokobayashi, Y.
Primary Citation of Related Structures: 9L6X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Large ribosomal subunit protein eL8 | A | 119 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Dsm 4304 / Jcm 9628 / Nbrc 100126 / Vc-16) , Synthetic Construct | SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNRTTHAVYRGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGGWPIGASAAIINEGELRKELGSLVEKIKGLQK |
Large ribosomal subunit protein eL8 | C | 119 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Dsm 4304 / Jcm 9628 / Nbrc 100126 / Vc-16) , Synthetic Construct | SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNRTTHAVYRGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGGWPIGASAAIINEGELRKELGSLVEKIKGLQK |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-12-25
Deposition Author(s): Fukunaga, K. , Kakuta, Y. , Nakashima, M. , Teramoto, T. , Yokobayashi, Y.