A peptide derived from the extracellular domain of the human trpv3 channel
PDB DOI: 10.2210/pdb9kvr/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2024-12-05 Deposition Author(s): Deng, Z. , Li, H.W. , Wang, C.X. , Zhang, W.B.
Method: SOLUTION NMR Resolution: N.A.
A peptide derived from the extracellular domain of the human trpv3 channel
Deng, Z. , Li, H.W. , Wang, C.X. , Zhang, W.B.
Primary Citation of Related Structures: 9KVR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transient receptor potential cation channel subfamily V member 3 | A | 31 | N.A. | SYYRPREEEAIPHPLALTHKMGWLQLLGRMF |
Method: SOLUTION NMR
Deposited Date: 2024-12-05 Deposition Author(s): Deng, Z. , Li, H.W. , Wang, C.X. , Zhang, W.B.