Crystal structure of the thermotoga maritima cold shock protein mutant est#13 in complex with aacest
PDB DOI: 10.2210/pdb9ju4/pdb
Classification: PROTEIN BINDING Organism(s): Alicyclobacillus Acidocaldarius , Thermotoga Maritima
Deposited: 2024-10-07 Deposition Author(s): Amesaka, H. , Tanaka, S.-I.
Crystal structure of the thermotoga maritima cold shock protein mutant est#13 in complex with aacest
Primary Citation of Related Structures: 9JU4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alpha/beta hydrolase fold-3 domain protein | A | 310 | Alicyclobacillus Acidocaldarius , Thermotoga Maritima | MPLDPVIQQVLDQLNRMPAPDYKHLSAQQFRSQQSLFPPVKKEPVAEVREFDMDLPGRTLKVRMYRPEGVEPPYPALVYYHGGGWVVGDLETHDPVCRVLAKDGRAVVFSVDYRLAPEHKFPAAVEDAYDALQWIAERAADFHLDPARIAVGGDSAGGNLAAVTSILAKERGGPAIAFQLLIYPSTGYDPAHPPASIEENAEGYLLTGGMMLWFRDQYLNSLEELTHPWFSPVLYPDLSGLPPAYIATAQYDPLRDVGKLYAEALNKAGVKVEIENFEDLIHGFAQFYSLSPGATKALVRIAEKLRDALA |
| The Thermotoga maritima cold shock protein mutant binding to AacEst | B | 66 | Alicyclobacillus Acidocaldarius , Thermotoga Maritima | RGKVKWFHDYYGYGFITKDEGGDVFVNADAIDMEGFKTLKEGQVVEFEIDSTVANAPQAAHVKVVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-10-07 Deposition Author(s): Amesaka, H. , Tanaka, S.-I.