Crystal structure of a cupin protein (tm1459) in iron (fe) substituted form
PDB DOI: 10.2210/pdb9jeu/pdb
Classification: METAL BINDING PROTEIN Organism(s): Thermotoga Maritima
Deposited: 2024-09-03 Deposition Author(s): Fujieda, N. , Ichihashi, H. , Itoh, S. , Kurisu, G.
Method: X-RAY DIFFRACTION Resolution: 1.19 Å
Crystal structure of a cupin protein (tm1459) in iron (fe) substituted form
Fujieda, N. , Ichihashi, H. , Itoh, S. , Kurisu, G.
Primary Citation of Related Structures: 9JEU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cupin type-2 domain-containing protein | A | 118 | Thermotoga Maritima | GPSGMILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRHSHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCLIPKEGGE |
| Cupin type-2 domain-containing protein | B | 118 | Thermotoga Maritima | GPSGMILKRAYDVTPQKISTDKVRGVRKRVLIGLKDAPNFVMRLFTVEPGGLIDRHSHPWEHEIFVLKGKLTVLKEQGEETVEEGFYIFVEPNEIHGFRNDTDSEVEFLCLIPKEGGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-09-03 Deposition Author(s): Fujieda, N. , Ichihashi, H. , Itoh, S. , Kurisu, G.