Crystal structure of sortase e from thermobifida fusca
PDB DOI: 10.2210/pdb9iok/pdb
Classification: HYDROLASE Organism(s): Thermobifida Fusca Yx
Deposited: 2024-07-09 Deposition Author(s): Krishnan, V. , Megta, A. , Murmu, S. , Roy, R.P. , Sharma, V.
Crystal structure of sortase e from thermobifida fusca
Krishnan, V. , Megta, A. , Murmu, S. , Roy, R.P. , Sharma, V.
Primary Citation of Related Structures: 9IOK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidase C60, sortase A and B | A | 181 | Thermobifida Fusca Yx | MEPLPGSANSRLYIPKTDQNWVVVSGVGPEDIKYGPGWYPESWTPEGMVPAARAGQPGNYAVAGHRVAAVFWDLDKLEEGDELVLEDAENFYTYQVVESKVVLPNAIEVIAPDPFNPESTEEPEKAYLTLTTCHPKLQNSHRLIVHAELVDTRPKERGMPDNIAHMAPENEEGLEHHHHHH |
| Peptidase C60, sortase A and B | B | 181 | Thermobifida Fusca Yx | MEPLPGSANSRLYIPKTDQNWVVVSGVGPEDIKYGPGWYPESWTPEGMVPAARAGQPGNYAVAGHRVAAVFWDLDKLEEGDELVLEDAENFYTYQVVESKVVLPNAIEVIAPDPFNPESTEEPEKAYLTLTTCHPKLQNSHRLIVHAELVDTRPKERGMPDNIAHMAPENEEGLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-07-09 Deposition Author(s): Krishnan, V. , Megta, A. , Murmu, S. , Roy, R.P. , Sharma, V.