Crystal structure of chimeric ufc1, tak motif replaced with hpn motif of other e2 proteins
PDB DOI: 10.2210/pdb9i9m/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2025-02-06 Deposition Author(s): Banerjee, S. , Manoj Kumar, P. , Wiener, R.
Crystal structure of chimeric ufc1, tak motif replaced with hpn motif of other e2 proteins
Banerjee, S. , Manoj Kumar, P. , Wiener, R.
Primary Citation of Related Structures: 9I9M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin-fold modifier-conjugating enzyme 1 | AAA | 169 | Homo Sapiens | GSMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKHPNMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIHHKEKCNQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2025-02-06 Deposition Author(s): Banerjee, S. , Manoj Kumar, P. , Wiener, R.