9HGD
Crystal structure of human gabarap in complex with cyclic peptide gab_d23
PDB DOI: 10.2210/pdb9hgd/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2024-11-19 Deposition Author(s): Ueffing, A. , Weiergraeber, O.H. , Willbold, D. , Wilms, J.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Crystal structure of human gabarap in complex with cyclic peptide gab_d23
Ueffing, A. , Weiergraeber, O.H. , Willbold, D. , Wilms, J.A.
Primary Citation of Related Structures: 9HGD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gamma-aminobutyric acid receptor-associated protein | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Gamma-aminobutyric acid receptor-associated protein | C | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| GAB_D23 | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LEDGWVDIETGKE |
| GAB_D23 | D | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LEDGWVDIETGKE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2024-11-19 Deposition Author(s): Ueffing, A. , Weiergraeber, O.H. , Willbold, D. , Wilms, J.A.