Bfl1 covalently bound to inhibitor compound 39
PDB DOI: 10.2210/pdb9gir/pdb
Classification: APOPTOSIS Organism(s): Homo Sapiens
Deposited: 2024-08-19 Deposition Author(s): Cottee, M.A.
Bfl1 covalently bound to inhibitor compound 39
Primary Citation of Related Structures: 9GIR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bcl-2-related protein A1 | A | 152 | Homo Sapiens | GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-08-19 Deposition Author(s): Cottee, M.A.