Studies on chimeric peafb
PDB DOI: 10.2210/pdb9fqg/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Penicillium Expansum
Deposited: 2024-06-17 Deposition Author(s): Gallego Del Sol, F. , Marina, A.
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
Studies on chimeric peafb
Gallego Del Sol, F. , Marina, A.
Primary Citation of Related Structures: 9FQG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PeAfpB chimeric | A | 58 | Penicillium Expansum | LSKYGGECSKKDNTCTYRKDGKDHIVKCPSADNKKCEKDKNKCEYDDHHKTVDCQTPV |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-17 Deposition Author(s): Gallego Del Sol, F. , Marina, A.