Human nudt1 with medetomidine
PDB DOI: 10.2210/pdb9fl6/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2024-06-04 Deposition Author(s): Elkins, J.M. , Huber, K.V.M. , Salah, E.
Human nudt1 with medetomidine
Elkins, J.M. , Huber, K.V.M. , Salah, E.
Primary Citation of Related Structures: 9FL6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform p26 of Oxidized purine nucleoside triphosphate hydrolase | AAA | 158 | Homo Sapiens | GAMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-06-04 Deposition Author(s): Elkins, J.M. , Huber, K.V.M. , Salah, E.