Solution nmr structure of a peptide encompassing residues 2-36 of the human formin inf2
PDB DOI: 10.2210/pdb9fjw/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2024-05-31 Deposition Author(s): Alonso, M.A. , Comas, L. , Correas, I. , Jimenez, M.A. , Labat-De-Hoz, L.
Solution nmr structure of a peptide encompassing residues 2-36 of the human formin inf2
Alonso, M.A. , Comas, L. , Correas, I. , Jimenez, M.A. , Labat-De-Hoz, L.
Primary Citation of Related Structures: 9FJW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Inverted formin-2 | A | 35 | Homo Sapiens | SVKEGAQRKWAALKEKLGPQDSDPTEANLESADPE |
Method: SOLUTION NMR
Deposited Date: 2024-05-31 Deposition Author(s): Alonso, M.A. , Comas, L. , Correas, I. , Jimenez, M.A. , Labat-De-Hoz, L.